Oceanobacillus iheyensisHTE831[organism top]
ORF [ OB1261 ] Information
Gene Name : OB1261
Start/Stop Position : 1308458 / 1307154
Length : 434 aa
Direction : -
Start/Stop Codon : ATG / TAA
Molecular Weight : 47733.40
IsoElectric Point : 5.29
Product : 4-aminobutyrate aminotransferase (EC 2.6.1.19)
Note : similar to (nr):(sp|P30268|) percent identity 69 in 445 aa
Function :
EC Number : 2.6.1.19
Transmembrane Count : 0
Translation :
MNKSDQHWQELVNSIGNFLAPSMAKDHPNLPVVKAEGCYYYGTDGKEYLDFTSGIAVENV
GHRHPKVVQAIKDSADHLVHGPSGVIIYESILKLAQELQEIMPPKLDNFFFANSGTEAIE
GGLKLAKHVTKRPYVISFTGNFHGRSIGSLSVSTSKSKYRKYQQPSWLTYQLPYALPEYL
PEGQDPEVFFAEKLEKDAESLFKHQVDPEEVACMILEPIMGEGGYIIPPKSWLQKVREIC
DRHGILLIFDEVQTGFGRTGDWFAAQTFGVTPDIMAIAKGIAAGMPLSATVASKELMDQW
PLGSHGTTFGGNPIACAAARASLSIMKEEKLLNNAKTMGDYALTKLSGLKDKYEIVHEVR
GIGLMLGIELRDPETGEPDGEAVMKALNGCLDEGVLFYLCGNAGEVIRMIPPLTINKEQI
DQGIDVLDKVLAQM
Nt Sequence :
ATGAATAAATCAGATCAACATTGGCAAGAACTTGTAAACTCAATCGGAAATTTCTTAGCA
CCTAGTATGGCAAAAGATCATCCGAATCTTCCGGTAGTAAAAGCAGAAGGTTGTTACTAC
TATGGAACGGATGGAAAAGAATATTTAGATTTCACTTCTGGAATTGCCGTTGAAAATGTC
GGACATCGTCATCCTAAAGTAGTACAAGCGATAAAAGATAGTGCAGATCACCTTGTACAC
GGTCCATCAGGAGTAATTATCTATGAATCTATCTTAAAATTAGCACAAGAACTTCAAGAG
ATTATGCCACCAAAACTAGATAATTTCTTCTTTGCTAATAGTGGTACAGAAGCAATTGAA
GGTGGATTAAAGTTAGCTAAGCATGTGACAAAACGTCCATATGTCATTTCATTTACCGGA
AACTTCCATGGTCGCTCGATTGGTTCATTAAGTGTATCTACCTCAAAAAGTAAATATCGT
AAGTATCAACAACCATCATGGTTAACGTATCAATTACCATACGCTCTGCCAGAATACTTA
CCAGAAGGACAAGACCCAGAAGTATTCTTTGCAGAAAAGCTAGAGAAAGATGCAGAATCC
CTTTTCAAACATCAGGTAGACCCTGAAGAAGTAGCATGTATGATACTGGAACCAATTATG
GGCGAAGGTGGTTACATCATCCCACCTAAATCATGGTTACAAAAAGTACGTGAAATCTGT
GATCGTCATGGTATTTTACTCATTTTTGATGAAGTACAAACTGGATTTGGACGTACCGGT
GATTGGTTTGCAGCACAAACCTTTGGTGTTACACCTGACATTATGGCAATTGCAAAAGGA
ATCGCAGCAGGAATGCCATTAAGTGCCACTGTTGCATCTAAAGAACTCATGGATCAATGG
CCATTAGGTTCACACGGAACAACTTTTGGTGGTAACCCGATTGCTTGTGCAGCAGCACGC
GCTTCTCTTTCTATAATGAAAGAAGAAAAACTCCTTAACAATGCCAAGACAATGGGAGAT
TATGCATTAACCAAACTAAGCGGTCTAAAAGATAAATATGAGATTGTCCACGAAGTACGC
GGAATTGGCTTAATGCTAGGGATAGAACTGAGAGATCCTGAAACAGGTGAACCAGATGGT
GAAGCAGTAATGAAAGCTTTAAACGGCTGTTTAGATGAAGGAGTTTTATTCTATCTATGT
GGAAATGCAGGAGAAGTTATTCGAATGATTCCACCACTAACCATTAATAAAGAACAAATT
GATCAAGGAATCGATGTACTAGACAAAGTTCTAGCACAAATGTAA
Back to the previous page