Oceanobacillus iheyensisHTE831[organism top]
ORF [ OB1932 ] Information
Gene Name : OB1932
Start/Stop Position : 1959202 / 1958591
Length : 203 aa
Direction : -
Start/Stop Codon : ATG / TAA
Molecular Weight : 22672.12
IsoElectric Point : 5.21
Product : manganese superoxide dismutase (EC 1.15.1.1)
Note : similar to (nr):(sp|P00449|SODM_BACST) percent identity 84 in 199 aa
Function :
EC Number : 1.15.1.1
Transmembrane Count : 0
Translation :
MAKFELPELPYAYDALEPTIDKETMNIHHTKHHNTYVTKLNDALEGHADLQSKSVEELIS
NLDAVPENAKTAVRNNGGGHANHSLFWKLLSPNGGGEPTGELADKINAKFGSLDKFKEEF
AAAAAGRFGSGWAWLIVNNGELEITSTPNQDSPLMEGKTPVLGLDVWEHAYYLKYQNKRP
EYISAFWNVVNWDQVAKNYEEAK
Nt Sequence :
ATGGCAAAATTTGAATTACCGGAATTACCATATGCATATGATGCATTGGAACCGACAATT
GACAAAGAAACAATGAACATTCATCATACGAAACATCACAACACGTATGTAACTAAATTA
AATGATGCATTGGAAGGACATGCAGACCTTCAAAGTAAGTCTGTAGAAGAATTAATTAGT
AATCTTGATGCAGTCCCTGAAAATGCAAAAACTGCAGTACGTAACAATGGTGGCGGACAT
GCTAACCATAGCCTATTTTGGAAGTTATTATCACCAAATGGCGGCGGTGAGCCAACAGGT
GAATTAGCTGATAAAATTAATGCTAAATTTGGTTCATTAGACAAATTCAAAGAAGAATTT
GCAGCAGCTGCAGCAGGACGTTTCGGTTCTGGATGGGCTTGGCTAATTGTTAACAATGGT
GAACTAGAAATTACAAGCACACCAAACCAAGATTCACCATTAATGGAAGGAAAAACTCCT
GTATTAGGACTTGATGTTTGGGAACACGCTTATTATCTTAAATATCAAAACAAACGCCCA
GAGTACATTTCAGCATTCTGGAATGTAGTTAATTGGGATCAAGTTGCAAAAAACTACGAA
GAAGCTAAGTAA
Back to the previous page